PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.195180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 313aa    MW: 35413 Da    PI: 6.4265
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.195180.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-152067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
   Cucsa.195180.1 20 KGLWSPEEDEKLMRYMLNNGQGCWSDIARNAGLQRCGKSCRLRWINYL 67
                     678*******************************************97 PP

2Myb_DNA-binding50.93.7e-1673117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+v+++ + G++ W+ Ia++++ gRt++++k++w++ 
   Cucsa.195180.1  73 RGAFSPQEEELIVHLHSLIGNR-WSQIASRLP-GRTDNEIKNFWNST 117
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-241270IPR009057Homeodomain-like
PROSITE profilePS5129416.2071567IPR017930Myb domain
SuperFamilySSF466892.97E-2818114IPR009057Homeodomain-like
SMARTSM007178.6E-111969IPR001005SANT/Myb domain
PfamPF002496.3E-142067IPR001005SANT/Myb domain
CDDcd001673.29E-92367No hitNo description
PROSITE profilePS5129425.05968122IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2671123IPR009057Homeodomain-like
SMARTSM007171.3E-1572120IPR001005SANT/Myb domain
PfamPF002499.5E-1573117IPR001005SANT/Myb domain
CDDcd001671.30E-1075118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MRKPEAVLGK ENAEKNKYRK GLWSPEEDEK LMRYMLNNGQ GCWSDIARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EELIVHLHSL IGNRWSQIAS RLPGRTDNEI KNFWNSTLKK  120
RLKNNLSSSP YNHESSDPRL DMMFGGIMAM QEHDIMSMNM SMDSSSTSSS SSQLPFSATG  180
HNSFDGSSMP FLDNHFEMAS MAGNTNGFLQ APLTEMGMGM RSMEERFRYG SLEAQRSMEL  240
EREVLCVPHE EMNHPPLMNN RSSFDQYLGT NEQNLNVEEM FGDMGSHGQL QESLKMGDML  300
GTSTARALLL LG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-272012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818350.0LN681835.1 Cucumis melo genomic scaffold, anchoredscaffold00064.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149614.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0A0L9U41e-108A0A0A0L9U4_CUCSA; Uncharacterized protein
STRINGGLYMA12G36630.12e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-72myb domain protein 46